PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010909265.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family BES1
Protein Properties Length: 699aa    MW: 78417.3 Da    PI: 5.7999
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010909265.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822122.26.8e-3884156476
          DUF822   4 grkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 
                     +r +  +E+E++k RER+RRai+a+i++GLR++Gny+l++raD+neV+ AL+reAGw v +DGtt++  s   
  XP_010909265.1  84 RRPRAKEEKERTKMRERHRRAITARILSGLRRHGNYNLRARADINEVISALAREAGWAVLPDGTTFPSRSASS 156
                     34455668**********************************************************9443333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056872.0E-3484166IPR008540BES1/BZR1 plant transcription factor, N-terminal
SuperFamilySSF514456.49E-190256694IPR017853Glycoside hydrolase superfamily
Gene3DG3DSA:3.20.20.801.4E-208259693IPR013781Glycoside hydrolase, catalytic domain
PfamPF013738.5E-111265683IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76296310IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76317335IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76339360IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.1E-11422431IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007501.3E-76432454IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76505524IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76539555IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76556567IPR001554Glycoside hydrolase, family 14
PRINTSPR007501.3E-76574597IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.1E-11577587IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR007501.3E-76614636IPR001554Glycoside hydrolase, family 14
PRINTSPR008422.1E-11665679IPR001371Glycoside hydrolase, family 14B, plant
PRINTSPR008422.1E-11680694IPR001371Glycoside hydrolase, family 14B, plant
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000272Biological Processpolysaccharide catabolic process
GO:0048831Biological Processregulation of shoot system development
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0016161Molecular Functionbeta-amylase activity
Sequence ? help Back to Top
Protein Sequence    Length: 699 aa     Download sequence    Send to blast
MAQEMEKLGG TSEEEDDEEM EMEVKEEEDE EEEEEERGSG SREAAVMGMV AQPAGEDMGG  60
RYFQQPGRID GGGGXGLMQG VVMRRPRAKE EKERTKMRER HRRAITARIL SGLRRHGNYN  120
LRARADINEV ISALAREAGW AVLPDGTTFP SRSASSSPQG PPATSSVAPA HIQPLRGVSP  180
GGLRSAEFRP LKGVFTPTAA SASASYDGRC RTSVMMGGHR ERMVDSLPLA ASCTDGVHGK  240
QVADILPTHR MPEHDFAGTP YVPVYVMLPL GVINMKCELA DPKSLIKQLR ILRSVNVDGV  300
MVDCWWGIVE AHAPQEYNWN GYKRLFQIVR ELKLKLQVVM SFHECGGNIG DDVCIPLPHW  360
VAEIGRSNPE IFFTDREGRR NPECLSWGID KERVLRGRTA LEVYFDYMRS FRVEFDEFFE  420
DGIISEIEVG LGPCGELRYP SYPVKHGWRY PGIGEFQCYD QYLMKSLRKA AEARGHSFWA  480
RGPDNAGFYN SQPHETGFFC DGGDYDSYYG RFFLNWYSQV LVDHADRVLS LAKLAFEGTC  540
IAAKISGVHW WYKTASHAAE LTAGFYNPCN RDGYASIASM LKRHGAALNF TCAELRTLDQ  600
HKEFPEALAD PEGLVWQVLN AAWDVCIPVA SENALPCHDR AGYNKILENS KPMNDPDGRH  660
LSAFTYLRLS PDLMESHNFL EFERFVKRMH GEAVLDLQA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1uko_A1e-16126169211444Beta-amylase
1uko_B1e-16126169211444Beta-amylase
1uko_C1e-16126169211444Beta-amylase
1uko_D1e-16126169211444Beta-amylase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010909265.10.0PREDICTED: LOW QUALITY PROTEIN: beta-amylase 2, chloroplastic-like
SwissprotO808310.0BAM7_ARATH; Beta-amylase 7
TrEMBLF6I6260.0F6I626_VITVI; Beta-amylase
STRINGVIT_15s0046g02640.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP21413663
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G45880.10.0beta-amylase 7